9
edits
Changes
MyWikiBiz, Author Your Legacy — Monday November 18, 2024
Jump to navigationJump to searchDirectory:LifeTein.com (view source)
Revision as of 01:28, 18 February 2010
, 01:28, 18 February 2010→Share this page: add more peptide contents
Ensured quality: Peptide synthesis projects are carried out by Fmoc and Boc chemistry under the strictest quality control based on HPLC and by mass spectrometry. 95% of all projects are finalized in 2-3 weeks to guarantee the on time delivery.
Ensured quality: Peptide synthesis projects are carried out by Fmoc and Boc chemistry under the strictest quality control based on HPLC and by mass spectrometry. 95% of all projects are finalized in 2-3 weeks to guarantee the on time delivery.
Data protection: All sequences supplied to LifeTein are considered the confidential property of the customer. LifeTein hereby disclaims any rights whatsoever on any intellectual property and know-how including any delivered peptide sequences and material supplied by the customer. At the completion of the project all synthetic peptide meeting the purity criteria is sent to the customer.
Data protection: All sequences supplied to LifeTein are considered the confidential property of the customer. LifeTein hereby disclaims any rights whatsoever on any intellectual property and know-how including any delivered peptide sequences and material supplied by the customer. At the completion of the project all synthetic peptide meeting the purity criteria is sent to the customer.
== Peptides - From Discovery to Therapeutics ==
[http://lifetein.com/product_literature.html Peptides] are short polyers formed from the peptide bond linking, in a defined order, of α-amino acids. The major classes of peptides include ribosomal peptides, non-ribosomal peptides, peptones and peptide fragments. The hypothalamic peptide hormone gonadotropin-releasing hormone (GnRH) is an example of ribosomal peptides. The peptide is synthesized by translation of mRNA. GnRH is subjected to a regulatory proteolytic pathway to generate the mature form. Non-ribosomal peptides are usually produced by bacteria or fungi. Nonribosomal peptides often have a cyclic and/or branched structures. For example, Bacitracin is a mixture of related cyclic polypeptides produced by organisms of the licheniformis group. Peptones are derived proteins, which may be produced by hydrolysis of a native protein with an acid or enzyme. Peptide fragments refer to fragments of proteins that are used to identify or quantify the source protein.
Peptides play an important role in molecular biology, biochemistry, immunology and medicine. Synthetic peptides have been widely used for structure-function studies of polypeptides. The processes involve initiation or inhibition through protein-protein interaction. Take a non-formyl peptide (HP-20) for example. The rapid intracellular calcium mobilization of HP-20 was measured for human neutrophils in order to explore its interaction with the formyl peptide receptor (FPR).
== [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology]==
The conventional [http://lifetein.com/peptide_synthesis_introduction.html#Peptide_synthesis_process solid phase peptide synthesis (SPPS)] typically uses long coupling time of up to one hour or more, extended deprotection times, multiple wash steps as well as Kaiser tests to insure complete acylations. This increases synthesis time especially when synthesizing the complex peptides such as beta-amyloid, which has high hydrophobicity of the C-terminal segment and subsequent on-resin aggregation. The rate of amino acid acylation is heavily dependent on the properties of the coupling. Therefore, the ability to assemble peptides faster with a reasonable quality is highly desirable.
[http://lifetein.com LifeTein's] [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] was developed from a campus core facility. It is a very practical platform for the synthesis of peptides for pharmaceutical companies, active pharmaceutical ingredient (API) purpose and university research laboratories. The [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] has been used for in-house testing of multiple selected biologically active peptides with a broad range of properties including long and short peptides, as well as peptides containing D-amino acids or pseudoproline dipeptides using various coupling reagents such as HBTU, HATU, HCTU, ByBroP, BOP, PyBOP and TBTU. The [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] allows us to have the flexibility to choose affordable, highly efficient coupling reagents for fast SPPS. One study using the [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] shows that the synthesis of the [http://lifetein.com/peptide_product.html human beta-amyloid (1-C42) peptide] (HDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH) using HCTU as activators renders a total synthesis time of 15 h with similar purity to the long synthesis. Wang-ChemMatrix, HMPB-ChemMatrix, and Wang-PSLL were compared for their efficiency on different synthesis.
Using appropriate coupling and deprotectant reagents linked to the correct resin, [http://lifetein.com LifeTein's] [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] provides our customers with reduced total peptide synthesis time and higher quality.
=== Share this page ===
=== Share this page ===
<sharethis />
<sharethis />
