Difference between revisions of "Directory:LifeTein.com"

MyWikiBiz, Author Your Legacy — Tuesday November 19, 2024
Jump to navigationJump to search
m
 
(3 intermediate revisions by the same user not shown)
Line 1: Line 1:
{{QuickAdd
+
== About [http://www.lifetein.com LifeTein]==
| Address = 150 Maple Avenue
 
| City = South Plainfield
 
| State = New Jersey
 
| Zip = 07080
 
| Country = USA
 
| Phone = 1-732-312-5852
 
| Email = info@lifetein.com
 
| Web = http://www.lifetein.com  
 
| Contact = Phil Moore
 
| Title = Director of Business Development
 
}}
 
  
== About [http://www.lifetein.com LifeTein]==
+
'''[http://www.lifetein.com LifeTein]''', located in South Plainfield, New Jersey. It was founded for its global custom peptide synthesis services and antibody production services. On the principles of understanding life one protein at a time, LifeTein provides expert collaborative research services to the biotech and pharmaceutical industries. LifeTein's scientists are originally from campus core facility. Therefore we understand the importance of your peptide and protein research.
  
'''[http://www.lifetein.com LifeTein]''', the peptide synthesis company, has developed its proprietary [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] (http://www.lifetein.com/peptide_tech.html), which was developed from our campus core facility. This technology provides continuous flow of peptide synthesis platform and renders competitive custom peptide synthesis price. Using the saved peptide production costs, we are able to serve the campus and now worldwide scientific community more cost-effectively. Thanks to the [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] using the Fmoc and Boc chemistry and a patented solid support resin, [http://www.lifetein.com LifeTein] offers high quality custom peptide synthesis services at very competitive peptide prices.
+
At LifeTein, we are dedicated to providing you with the optimal chemical, peptide and antibody related services to fit your needs. LifeTein is the only peptide synthesis manufacturer to have developed its own line of [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] platform for peptide synthesis and AdjuBooster for antibody production. The PeptideSyn technology is optimized to provide continuous flow of peptide synthesis with saved cost while at the same time maintaining high quality. This PeptideSyn technology has proven to significantly enhance the efficiency of synthesis. The AdjuBooster adjuvant can increase immune responses in a shorter time for our antibody services.
  
 
Try our custom peptide synthesis services (http://www.lifetein.com/peptide_synthesis_services.html) and [http://lifetein.com/media_center.html#testimonials listen to what our customers say] about our custom peptide synthesis services:
 
Try our custom peptide synthesis services (http://www.lifetein.com/peptide_synthesis_services.html) and [http://lifetein.com/media_center.html#testimonials listen to what our customers say] about our custom peptide synthesis services:
Line 37: Line 26:
  
 
Using appropriate coupling and deprotectant reagents linked to the correct resin, [http://lifetein.com LifeTein's] [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] provides our customers with reduced total peptide synthesis time and higher quality.  
 
Using appropriate coupling and deprotectant reagents linked to the correct resin, [http://lifetein.com LifeTein's] [http://lifetein.com/peptide_tech.html PeptideSyn Peptide Synthesis Technology] provides our customers with reduced total peptide synthesis time and higher quality.  
 +
 +
== [http://lifetein.com/antibody_services.html LifeTein Antibody Services] ==
 +
[http://www.lifetein.com LifeTein]provides a complete portfolio of antibody services which include [http://lifetein.com/peptide_synthesis_services.html peptide synthesis], [http://lifetein.com/custom_pAb_services.html polyclonal] and [http://lifetein.com/custom_mAb_services.html monoclonal production], development and purification services. As a leading provider of superior custom antibody development services to the research community, [http://lifetein.com LifeTein] offers a wide range of the industry leading platforms and services. [http://lifetein.com LifeTein] can customize a discovery and development path to meet your needs.
 +
 +
[http://lifetein.com LifeTein's] AdjuBooster adjuvant has been proven to increase immune responses in a shorter time for our antibody services. [http://lifetein.com LifeTein] scientists will work with you to generate custom antibodies for your research and development program.
 +
 +
<googlemap lat="40.582487" lon="-74.413265" zoom="19" controls="small">
 +
40.582353, -74.413265, 150 Maple Ave
 +
 +
South Plainfield, NJ
 +
</googlemap>
  
 
=== Share this page ===
 
=== Share this page ===
 
<sharethis />
 
<sharethis />

Latest revision as of 03:31, 15 December 2010

About LifeTein

LifeTein, located in South Plainfield, New Jersey. It was founded for its global custom peptide synthesis services and antibody production services. On the principles of understanding life one protein at a time, LifeTein provides expert collaborative research services to the biotech and pharmaceutical industries. LifeTein's scientists are originally from campus core facility. Therefore we understand the importance of your peptide and protein research.

At LifeTein, we are dedicated to providing you with the optimal chemical, peptide and antibody related services to fit your needs. LifeTein is the only peptide synthesis manufacturer to have developed its own line of PeptideSyn Peptide Synthesis Technology platform for peptide synthesis and AdjuBooster for antibody production. The PeptideSyn technology is optimized to provide continuous flow of peptide synthesis with saved cost while at the same time maintaining high quality. This PeptideSyn technology has proven to significantly enhance the efficiency of synthesis. The AdjuBooster adjuvant can increase immune responses in a shorter time for our antibody services.

Try our custom peptide synthesis services (http://www.lifetein.com/peptide_synthesis_services.html) and listen to what our customers say about our custom peptide synthesis services:

Large capacities: capacity to produce 5,000 purified peptides monthly ranging from crude to highly pure and complex peptides.

Ensured quality: Peptide synthesis projects are carried out by Fmoc and Boc chemistry under the strictest quality control based on HPLC and by mass spectrometry. 95% of all projects are finalized in 2-3 weeks to guarantee the on time delivery.

Data protection: All sequences supplied to LifeTein are considered the confidential property of the customer. At the completion of the project all synthetic peptide meeting the purity criteria is sent to the customer.

Peptides - From Discovery to Therapeutics

Peptides are short polyers formed from the peptide bond linking, in a defined order, of α-amino acids. The major classes of peptides include ribosomal peptides, non-ribosomal peptides, peptones and peptide fragments. The hypothalamic peptide hormone gonadotropin-releasing hormone (GnRH) is an example of ribosomal peptides. The peptide is synthesized by translation of mRNA. GnRH is subjected to a regulatory proteolytic pathway to generate the mature form. Non-ribosomal peptides are usually produced by bacteria or fungi. Nonribosomal peptides often have a cyclic and/or branched structures. For example, Bacitracin is a mixture of related cyclic polypeptides produced by organisms of the licheniformis group. Peptones are derived proteins, which may be produced by hydrolysis of a native protein with an acid or enzyme. Peptide fragments refer to fragments of proteins that are used to identify or quantify the source protein.

Peptides play an important role in molecular biology, biochemistry, immunology and medicine. Synthetic peptides have been widely used for structure-function studies of polypeptides. The processes involve initiation or inhibition through protein-protein interaction. Take a non-formyl peptide (HP-20) for example. The rapid intracellular calcium mobilization of HP-20 was measured for human neutrophils in order to explore its interaction with the formyl peptide receptor (FPR).

PeptideSyn Peptide Synthesis Technology

The conventional solid phase peptide synthesis (SPPS) typically uses long coupling time of up to one hour or more, extended deprotection times, multiple wash steps as well as Kaiser tests to insure complete acylations. This increases synthesis time especially when synthesizing the complex peptides such as beta-amyloid, which has high hydrophobicity of the C-terminal segment and subsequent on-resin aggregation. The rate of amino acid acylation is heavily dependent on the properties of the coupling. Therefore, the ability to assemble peptides faster with a reasonable quality is highly desirable.

LifeTein's PeptideSyn Peptide Synthesis Technology was developed from a campus core facility. It is a very practical platform for the synthesis of peptides for pharmaceutical companies, active pharmaceutical ingredient (API) purpose and university research laboratories. The PeptideSyn Peptide Synthesis Technology has been used for in-house testing of multiple selected biologically active peptides with a broad range of properties including long and short peptides, as well as peptides containing D-amino acids or pseudoproline dipeptides using various coupling reagents such as HBTU, HATU, HCTU, ByBroP, BOP, PyBOP and TBTU. The PeptideSyn Peptide Synthesis Technology allows us to have the flexibility to choose affordable, highly efficient coupling reagents for fast SPPS. One study using the PeptideSyn Peptide Synthesis Technology shows that the synthesis of the human beta-amyloid (1-C42) peptide (HDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH) using HCTU as activators renders a total synthesis time of 15 h with similar purity to the long synthesis. Wang-ChemMatrix, HMPB-ChemMatrix, and Wang-PSLL were compared for their efficiency on different synthesis.

Using appropriate coupling and deprotectant reagents linked to the correct resin, LifeTein's PeptideSyn Peptide Synthesis Technology provides our customers with reduced total peptide synthesis time and higher quality.

LifeTein Antibody Services

LifeTeinprovides a complete portfolio of antibody services which include peptide synthesis, polyclonal and monoclonal production, development and purification services. As a leading provider of superior custom antibody development services to the research community, LifeTein offers a wide range of the industry leading platforms and services. LifeTein can customize a discovery and development path to meet your needs.

LifeTein's AdjuBooster adjuvant has been proven to increase immune responses in a shorter time for our antibody services. LifeTein scientists will work with you to generate custom antibodies for your research and development program.

<googlemap lat="40.582487" lon="-74.413265" zoom="19" controls="small"> 40.582353, -74.413265, 150 Maple Ave

South Plainfield, NJ </googlemap>

Share this page

<sharethis />